PIAS4 anticorps (N-Term)

N° du produit ABIN4886695

Détail du produit anti-PIAS4 anticorps

Antigène: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Épitope: AA 130-174, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIAS4 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection. Tested with WB in Human,Mouse,Rat.

Séquence: EVRLVKLPFF NMLDELLKPT ELVPQNNEKL QESPCIFALT PRQVE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: protein inhibitor of activated STAT, 4
Protein Name: E3 SUMO-protein ligase PIAS4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human PIAS4 (130-174aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PIAS4

Antigène: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Autre désignation: PIAS4 (PIAS4 Produits)

Synonymes: anticorps PIASY, anticorps Piasg, anticorps ZMIZ6, anticorps pias4, anticorps piasy, anticorps wu:fc54c11, anticorps wu:fi18c10, anticorps wu:fi20e09, anticorps wu:fk93f11, anticorps zgc:66410, anticorps piasg, anticorps zmiz6, anticorps LOC100219439, anticorps Pias-gamma, anticorps pias4l, anticorps wu:fi26h11, anticorps zgc:63923, anticorps protein inhibitor of activated STAT 4, anticorps protein inhibitor of activated STAT, 4, anticorps protein inhibitor of activated STAT, 4a, anticorps protein inhibitor of activated STAT 4 L homeolog, anticorps protein inhibitor of activated STAT, 4b, anticorps PIAS4, anticorps Pias4, anticorps pias4a, anticorps pias4.L, anticorps pias4, anticorps pias4b

Sujet: E3 SUMO-protein ligase PIAS4, also known as protein inhibitor of activated STAT protein 4 (PIAS4) or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.

Synonyms: E3 SUMOprotein ligase PIAS4 | E3 SUMO-protein ligase PIAS4 | PIASG | PIASgamma | PIAS-gamma | PIASy | Q8N2W9

ID gène: 51588

UniProt: Q8N2W9

Pathways: Signalistation JAK/STAT, Interferon-gamma Pathway, Positive Regulation of Response to DNA Damage Stimulus