TUBB3 anticorps (C-Term)
-
- Antigène Voir toutes TUBB3 Anticorps
- TUBB3 (Tubulin, beta 3 (TUBB3))
-
Épitope
- AA 383-412, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TUBB3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- EQFTAMFRRK AFLHWYTGEG MDEMEFTEAE
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: tubulin beta 3 class III
Protein Name: Tubulin beta-3 chain - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product TUBB3 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 4254-4260, (2017) (PubMed).
: "Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats." dans: Molecular medicine reports, Vol. 12, Issue 4, pp. 5691-700, (2016) (PubMed).
: "The potential role of HMGB1 release in peritoneal dialysis-related peritonitis." dans: PLoS ONE, Vol. 8, Issue 1, pp. e54647, (2013) (PubMed).
: "
-
Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 4254-4260, (2017) (PubMed).
-
- Antigène
- TUBB3 (Tubulin, beta 3 (TUBB3))
- Autre désignation
- TUBB3 (TUBB3 Produits)
- Synonymes
- anticorps CDCBM, anticorps CFEOM3A, anticorps TUBB4, anticorps beta-4, anticorps TUBB3, anticorps 3200002H15Rik, anticorps M(beta)3, anticorps M(beta)6, anticorps tubb3, anticorps tubulin beta 3 class III, anticorps tubulin, beta 3 class III, anticorps tubulin beta 3 class III L homeolog, anticorps beta-tubulin 3, anticorps tubulin beta-3 chain, anticorps beta tubulin 3, anticorps TUBB3, anticorps Tubb3, anticorps tubb3, anticorps tubb3.L, anticorps LOC100581245, anticorps tub3
- Sujet
-
Tubulin beta-3 chain is a protein that in humans is encoded by the TUBB3 gene. This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
Synonyms: beta 3 tubulin | beta-4 | CDCBM | CDCBM1 | CFEOM3A | CFEOM3 | FEOM3 | M(beta)3 | M(beta)6 | MC1R | Tubb 3 | TUBB3 | TUBB4 | Tubulin beta 3 | Tubulin beta 3 chain | Tubulin beta 4 | Tubulin beta-4 chain | Tubulin beta III | Tubulin beta-III | Q13509 - ID gène
- 10381
- UniProt
- Q13509
- Pathways
- Dynamique des Microtubules, M Phase
-