Aquaporin 1 anticorps

N° du produit ABIN4950191

Détail du produit anti-Aquaporin 1 anticorps

Antigène: Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aquaporin 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1 were used as the immunogen for the Aquaporin 1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Aquaporin 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Aquaporin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Aquaporin 1

Antigène: Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))

Autre désignation: AQP1 / Aquaporin 1 (AQP1 Produits)

Synonymes: anticorps fj33g04, anticorps zgc:85890, anticorps wu:fj33g04, anticorps AQP1, anticorps CHIP28, anticorps AQP-CHIP, anticorps CO, anticorps AQP-1, anticorps CHIP29, anticorps aquaporin 1a (Colton blood group), tandem duplicate 1, anticorps aquaporin 1, anticorps aquaporin 1 (Colton blood group), anticorps aqp1a.1, anticorps AQP1, anticorps Aqp1

Sujet: Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

UniProt: P29972

Pathways: Hormone Transport