ARID1A anticorps

N° du produit ABIN4950208

Détail du produit anti-ARID1A anticorps

Antigène: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARID1A est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR of human ARID1A were used as the immunogen for the ARID1A antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ARID1A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ARID1A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ARID1A

Antigène: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Autre désignation: ARID1A (ARID1A Produits)

Synonymes: anticorps B120, anticorps BAF250, anticorps BAF250a, anticorps BM029, anticorps C1orf4, anticorps ELD, anticorps MRD14, anticorps OSA1, anticorps P270, anticorps SMARCF1, anticorps hELD, anticorps hOSA1, anticorps 1110030E03Rik, anticorps Osa1, anticorps Smarcf1, anticorps ARID1A, anticorps wu:fb79b07, anticorps wu:fb95g08, anticorps zgc:171438, anticorps AT-rich interaction domain 1A, anticorps AT rich interactive domain 1A (SWI-like), anticorps AT rich interactive domain 1Aa (SWI-like), anticorps ARID1A, anticorps Arid1a, anticorps arid1a, anticorps arid1aa

Sujet: AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.

UniProt: O14497

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Tube Formation