B3GNT8 anticorps

N° du produit ABIN4950282

Détail du produit anti-B3GNT8 anticorps

Antigène: B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B3GNT8 est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC of human B3GNT8 were used as the immunogen for the B3GNT8 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the B3GNT8 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the B3GNT8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur B3GNT8

Antigène: B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))

Autre désignation: B3GNT8 (B3GNT8 Produits)

Synonymes: anticorps B3GALT7, anticorps BGALT15, anticorps beta3Gn-T8, anticorps B3galt7, anticorps B7galt7, anticorps BC025206, anticorps UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8, anticorps B3GNT8, anticorps B3gnt8

Sujet: B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn(2+) and showed less efficiency with Co(2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans.

UniProt: Q7Z7M8