CPT1B anticorps

N° du produit ABIN4950637

Détail du produit anti-CPT1B anticorps

Antigène: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPT1B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purification: Antigen affinity

Immunogène: Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B were used as the immunogen for the CPT1B antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CPT1B antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CPT1B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CPT1B

Antigène: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Autre désignation: CPT1B (CPT1B Produits)

Synonymes: anticorps CPT1-M, anticorps CPT1M, anticorps CPTI, anticorps CPTI-M, anticorps M-CPT1, anticorps MCCPT1, anticorps MCPT1, anticorps CPT-IB, anticorps M-CPTI, anticorps CPT1, anticorps CPTIB, anticorps cpt1al, anticorps zgc:103709, anticorps CPT1B, anticorps MGC147544, anticorps Cpt1, anticorps Cpt1-m, anticorps Cpti, anticorps Cpti-m, anticorps M-cpti, anticorps carnitine palmitoyltransferase 1B, anticorps carnitine palmitoyltransferase 1B (muscle), anticorps carnitine palmitoyltransferase 1B L homeolog, anticorps carnitine palmitoyltransferase 1b, muscle, anticorps CPT1B, anticorps Cpt1b, anticorps cpt1b, anticorps cpt1b.L

Sujet: CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

UniProt: Q92523

Pathways: AMPK Signaling, Monocarboxylic Acid Catabolic Process