DARPP32 anticorps

N° du produit ABIN4950763

Détail du produit anti-DARPP32 anticorps

Antigène: DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DARPP32 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA of human DARPP-32 were used as the immunogen for the DARPP-32 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the DARPP-32 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the DARPP-32 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur DARPP32

Antigène: DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))

Autre désignation: DARPP-32 (PPP1R1B Produits)

Synonymes: anticorps darpp32, anticorps darpp-32, anticorps Darpp-32, anticorps Darpp32, anticorps DARPP-32, anticorps DARPP32, anticorps AU040756, anticorps protein phosphatase 1 regulatory inhibitor subunit 1B, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 1B, anticorps protein phosphatase 1 regulatory inhibitor subunit 1B S homeolog, anticorps ppp1r1b, anticorps PPP1R1B, anticorps Ppp1r1b, anticorps ppp1r1b.S

Sujet: Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9UD71