G Protein-Coupled Receptor Kinase 5 (GRK5) anticorps

Détails pour le produit réf. ABIN4951249
Antigène
  • GPRK5
  • Gprk5
  • si:dkey-171l20.1
  • GRK5
  • DKFZp468J1119
  • grk5
  • G protein-coupled receptor kinase 5
  • G protein-coupled receptor kinase 5 L homeolog
  • GRK5
  • Grk5
  • grk5
  • grk5.L
Reactivité
Humain, Souris, Rat (Rattus)
129
80
61
13
8
8
5
5
4
4
4
4
3
1
1
1
1
1
Hôte
Lapin
100
31
1
Clonalité
Polyclonal
Conjugué
Inconjugué
5
5
4
4
3
3
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
92
43
40
31
28
27
5
2
1
1
Options
Immunogène Amino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation GRK5 (GRK5 Antibody Extrait)
Sujet G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).
UniProt P34947
Pathways Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
Indications d'application Optimal dilution of the GRK5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GRK5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-G Protein-Coupled Receptor Kinase 5 (GRK5) antibody (ABIN4951249) IHC testing of FFPE mouse lung with GRK5 antibody. HIER: Boil the paraffin sections i...
Image no. 2 for anti-G Protein-Coupled Receptor Kinase 5 (GRK5) antibody (ABIN4951249) Western blot testing of 1) rat lung, human 2) HeLa, 3) HepG2 and 4) SMMC lysate with ...
Image no. 3 for anti-G Protein-Coupled Receptor Kinase 5 (GRK5) antibody (ABIN4951249) IHC testing of FFPE rat heart with GRK5 antibody. HIER: Boil the paraffin sections in...
Avez-vous cherché autre chose?