GRK5 anticorps

N° du produit ABIN4951249

Détail du produit anti-GRK5 anticorps

Antigène: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRK5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GRK5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the GRK5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur GRK5

Antigène: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Autre désignation: GRK5 (GRK5 Produits)

Synonymes: anticorps GPRK5, anticorps Gprk5, anticorps si:dkey-171l20.1, anticorps GRK5, anticorps DKFZp468J1119, anticorps grk5, anticorps G protein-coupled receptor kinase 5, anticorps G protein-coupled receptor kinase 5 L homeolog, anticorps GRK5, anticorps Grk5, anticorps grk5, anticorps grk5.L

Sujet: G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

UniProt: P34947

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling