IRF5 anticorps

N° du produit ABIN4951486

Détail du produit anti-IRF5 anticorps

Antigène: IRF5 (Interferon Regulatory Factor 5 (IRF5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IRF5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IRF5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IRF5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur IRF5

Antigène: IRF5 (Interferon Regulatory Factor 5 (IRF5))

Autre désignation: IRF5 (IRF5 Produits)

Synonymes: anticorps IRF5, anticorps irf5, anticorps SLEB10, anticorps AW491843, anticorps mirf5, anticorps im:7155364, anticorps zgc:76986, anticorps interferon regulatory factor 5, anticorps interferon regulatory factor 5 L homeolog, anticorps IRF5, anticorps irf5, anticorps Irf5, anticorps irf5.L

Sujet: Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity.

UniProt: Q13568

Pathways: Signalisation TLR, Autophagy