IRF5 anticorps
-
- Antigène Voir toutes IRF5 Anticorps
- IRF5 (Interferon Regulatory Factor 5 (IRF5))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IRF5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogène
- Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product IRF5 Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the IRF5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the IRF5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- IRF5 (Interferon Regulatory Factor 5 (IRF5))
- Autre désignation
- IRF5 (IRF5 Produits)
- Synonymes
- anticorps IRF5, anticorps irf5, anticorps SLEB10, anticorps AW491843, anticorps mirf5, anticorps im:7155364, anticorps zgc:76986, anticorps interferon regulatory factor 5, anticorps interferon regulatory factor 5 L homeolog, anticorps IRF5, anticorps irf5, anticorps Irf5, anticorps irf5.L
- Sujet
- Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity.
- UniProt
- Q13568
- Pathways
- Signalisation TLR, Autophagy
-