IRF5 anticorps (Interferon Regulatory Factor 5)

Details for Product anti-IRF5 Antibody No. ABIN4951486
Antigène
  • IRF5
  • irf5
  • SLEB10
  • AW491843
  • mirf5
  • im:7155364
  • zgc:76986
  • interferon regulatory factor 5
  • interferon regulatory factor 5 L homeolog
  • IRF5
  • irf5
  • Irf5
  • irf5.L
Reactivité
Humain, Souris, Rat (Rattus)
126
65
43
8
7
7
6
5
4
3
3
Hôte
Lapin
96
33
8
2
Clonalité
Polyclonal
Conjugué
Cet anticorp IRF5 est non-conjugé
6
3
3
3
3
3
3
3
3
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
116
57
34
22
18
13
13
8
7
4
3
2
2
2
Options
Immunogène Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others IRF5 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation IRF5 (IRF5 Antibody Extrait)
Sujet Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity.
UniProt Q13568
Pathways Signalisation TLR, Autophagy
Indications d'application Optimal dilution of the IRF5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the IRF5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Interferon Regulatory Factor 5 (IRF5) antibody (ABIN4951486) Western blot testing of 1) rat intestine, 2) human HeLa, 3) human COLO320, 4) mouse N...
Image no. 2 for anti-Interferon Regulatory Factor 5 (IRF5) antibody (ABIN4951486) IHC testing of FFPE rat spleen with IRF5 antibody. HIER: Boil the paraffin sections i...
Image no. 3 for anti-Interferon Regulatory Factor 5 (IRF5) antibody (ABIN4951486) IHC testing of FFPE mouse spleen with IRF5 antibody. HIER: Boil the paraffin sections...
Avez-vous cherché autre chose?