LIM Domain Kinase 1 anticorps (LIMK1)

Details for Product anti-LIMK1 Antibody No. ABIN4951616
Antigène
  • limk1
  • xlimk1
  • GB16654
  • LIMK1
  • LIMK
  • LIMK-1
  • LIM domain kinase 1
  • LIM domain kinase 1a
  • LIM domain kinase 1 L homeolog
  • LIM-domain containing, protein kinase
  • LIMK1
  • limk1a
  • limk1
  • CpipJ_CPIJ000717
  • LOC413152
  • Limk1
  • limk1.L
Reactivité
Humain, Souris, Rat (Rattus)
258
141
129
4
4
2
2
2
2
2
1
1
Hôte
Lapin
197
64
3
Clonalité
Polyclonal
Conjugué
Cet anticorp LIM Domain Kinase 1 est non-conjugé
12
8
6
5
5
5
5
5
5
4
4
4
1
1
1
1
1
Application
Western Blotting (WB)
201
111
87
58
38
30
17
15
13
6
5
4
1
Options
Immunogène Amino acids KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR of human LIMK1 were used as the immunogen for the LIMK antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others LIM Domain Kinase 1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation LIM Kinase 1 / LIMK1 (LIMK1 Antibody Extrait)
Sujet LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.
UniProt P53667
Pathways Caspase Cascade in Apoptosis, Regulation of Cell Size, CXCR4-mediated Signaling Events
Indications d'application Optimal dilution of the LIMK antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the LIMK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-LIM Domain Kinase 1 (LIMK1) antibody (ABIN4951616) Western blot testing of 1) rat brain, 2) mouse stomach, human 3) HeLa, 4) U87 and 5) ...
Avez-vous cherché autre chose?