LIM Domain Kinase 1 anticorps

N° du produit ABIN4951616

Détail du produit anti-LIM Domain Kinase 1 anticorps

Antigène: LIM Domain Kinase 1 (LIMK1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIM Domain Kinase 1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR of human LIMK1 were used as the immunogen for the LIMK antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the LIMK antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the LIMK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur LIM Domain Kinase 1

Antigène: LIM Domain Kinase 1 (LIMK1)

Autre désignation: LIM Kinase 1 / LIMK1 (LIMK1 Produits)

Synonymes: anticorps limk1, anticorps xlimk1, anticorps GB16654, anticorps LIMK1, anticorps LIMK, anticorps LIMK-1, anticorps LIM domain kinase 1, anticorps LIM domain kinase 1a, anticorps LIM domain kinase 1 L homeolog, anticorps LIM-domain containing, protein kinase, anticorps LIMK1, anticorps limk1a, anticorps limk1, anticorps CpipJ_CPIJ000717, anticorps LOC413152, anticorps Limk1, anticorps limk1.L

Sujet: LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

UniProt: P53667

Pathways: Caspase Cascade in Apoptosis, Regulation of Cell Size, CXCR4-mediated Signaling Events