LYZ anticorps

N° du produit ABIN4951652

Détail du produit anti-LYZ anticorps

Antigène: LYZ (Lysozyme (LYZ))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYZ est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Lysozyme antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Lysozyme antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur LYZ

Antigène: LYZ (Lysozyme (LYZ))

Autre désignation: Lysozyme / LYZ (LYZ Produits)

Synonymes: anticorps LZM, anticorps 1, anticorps LYZC, anticorps lys-C, anticorps zgc:136734, anticorps BmLys, anticorps LYS, anticorps LZ, anticorps LYZS, anticorps lysozyme C, anticorps LYZ, anticorps lysozyme, anticorps lysozyme, anticorps lysozyme (renal amyloidosis), anticorps lysozyme L homeolog, anticorps serum lysozyme, anticorps LYZ, anticorps lyz, anticorps Lzm, anticorps LOC781146, anticorps lyz.L, anticorps S-LZ

Sujet: In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

UniProt: P61626