Lysozyme (LYZ) anticorps

Détails pour le produit réf. ABIN4951652
Antigène
  • LZM
  • 1
  • LYZC
  • lys-C
  • zgc:136734
  • BmLys
  • LYS
  • LZ
  • LYZS
  • lysozyme C
  • LYZ
  • lysozyme
  • lysozyme
  • lysozyme (renal amyloidosis)
  • lysozyme L homeolog
  • serum lysozyme
  • LYZ
  • lyz
  • Lzm
  • LOC781146
  • lyz.L
  • S-LZ
Reactivité
Humain, Rat (Rattus)
180
48
33
22
7
5
3
3
3
3
2
2
2
1
1
1
1
1
1
Hôte
Lapin
164
49
4
2
2
Clonalité
Polyclonal
Conjugué
Inconjugué
14
14
6
5
3
3
3
3
3
3
3
2
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
115
88
61
40
33
30
29
18
17
15
14
14
4
4
3
3
3
2
1
1
1
1
1
1
Options
Immunogène Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Lysozyme / LYZ (LYZ Antibody Extrait)
Sujet In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
UniProt P61626
Indications d'application Optimal dilution of the Lysozyme antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Lysozyme antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Lysozyme (LYZ) antibody (ABIN4951652) Wesern blot testing of 1) rat intestine, 2) rat kidney, 3) rat liver, and human 4) He...
Avez-vous cherché autre chose?