NDRG2 anticorps

N° du produit ABIN4951848

Détail du produit anti-NDRG2 anticorps

Antigène: NDRG2 (NDRG Family Member 2 (NDRG2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDRG2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER of human NDRG2 were used as the immunogen for the NDRG2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the NDRG2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the NDRG2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur NDRG2

Antigène: NDRG2 (NDRG Family Member 2 (NDRG2))

Autre désignation: NDRG2 (NDRG2 Produits)

Synonymes: anticorps NDRG2, anticorps AI182517, anticorps AU040374, anticorps Ndr2, anticorps SYLD, anticorps im:6909381, anticorps si:dkey-88n24.1, anticorps zgc:101847, anticorps NDRG family member 2, anticorps N-myc downstream regulated gene 2, anticorps NDRG family member 2 S homeolog, anticorps ndrg2, anticorps NDRG2, anticorps Ndrg2, anticorps ndrg2.S

Sujet: NDRG2 contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation. [UniProt]

UniProt: Q9UN36