SLC10A1 anticorps

N° du produit ABIN4951952

Détail du produit anti-SLC10A1 anticorps

Antigène: SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC10A1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purification: Antigen affinity

Immunogène: Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the NTCP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,IF (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the NTCP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SLC10A1

Antigène: SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))

Autre désignation: SLC10A1 / NTCP (SLC10A1 Produits)

Synonymes: anticorps Ntcp, anticorps NTCP, anticorps Ntcp1, anticorps SBACT, anticorps solute carrier family 10 (sodium/bile acid cotransporter family), member 1, anticorps solute carrier family 10 member 1, anticorps Slc10a1, anticorps SLC10A1

Sujet: Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.

UniProt: O08705