Parvin alpha anticorps
-
- Antigène Voir toutes Parvin alpha (PARVA) Anticorps
- Parvin alpha (PARVA) (Parvin, alpha (PARVA))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Parvin alpha est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogène
- Amino acids QKLQTVLEKINETLKLPPRSIKWNVDSVHAK of human Parvin alpha were used as the immunogen for the PARVA antibody.
- Isotype
- IgG
- Top Product
- Discover our top product PARVA Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the PARVA antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the PARVA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- Parvin alpha (PARVA) (Parvin, alpha (PARVA))
- Autre désignation
- Parvin alpha / PARVA (PARVA Produits)
- Synonymes
- anticorps CH-ILKBP, anticorps MXRA2, anticorps Actp, anticorps 2010012A22Rik, anticorps 5430400F08Rik, anticorps AI225929, anticorps AU042898, anticorps Parvin, anticorps parva, anticorps wu:fc59e06, anticorps zgc:101643, anticorps PARVA, anticorps Parva, anticorps parvin alpha, anticorps parvin, alpha, anticorps parvin, alpha a, anticorps PARVA, anticorps Parva, anticorps parvaa
- Sujet
- Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.
- UniProt
- Q9NVD7
- Pathways
- Smooth Muscle Cell Migration
-