Peroxiredoxin 4 anticorps

N° du produit ABIN4952125

Détail du produit anti-Peroxiredoxin 4 anticorps

Antigène: Peroxiredoxin 4 (PRDX4)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peroxiredoxin 4 est non-conjugé

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Peroxiredoxin 4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,ICC: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Peroxiredoxin 4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Peroxiredoxin 4

Antigène: Peroxiredoxin 4 (PRDX4)

Autre désignation: Peroxiredoxin 4 / PRDX4 (PRDX4 Produits)

Synonymes: anticorps MGC82793, anticorps prdx4, anticorps MGC79732, anticorps PRDX4, anticorps AOE37-2, anticorps PRX-4, anticorps AOE372, anticorps Prx-iv, anticorps Prx4, anticorps TRANK, anticorps fb59c09, anticorps wu:fb59c09, anticorps zgc:162938, anticorps peroxiredoxin 4, anticorps peroxiredoxin 4 L homeolog, anticorps PRDX4, anticorps prdx4.L, anticorps prdx4, anticorps Prdx4

Sujet: PRDX4 (Peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.

UniProt: Q13162