RAB18 anticorps

N° du produit ABIN4952337

Détail du produit anti-RAB18 anticorps

Antigène: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB18 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE of human RAB18 were used as the immunogen for the RAB18 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the RAB18 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the RAB18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur RAB18

Antigène: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Autre désignation: RAB18 (RAB18 Produits)

Synonymes: anticorps RAB18LI1, anticorps WARBM3, anticorps AA959686, anticorps RAB18, anticorps rab18li1, anticorps LOC100219058, anticorps rab18, anticorps zgc:92523, anticorps fc62e07, anticorps wu:fc62e07, anticorps zgc:77145, anticorps RAB18, member RAS oncogene family, anticorps ras-related protein Rab-18-B, anticorps ras-related protein Rab-18-like, anticorps Ras-related protein Rab-18, anticorps RAB18, member RAS oncogene family S homeolog, anticorps RAB18B, member RAS oncogene family, anticorps RAB18A, member RAS oncogene family, anticorps RAB18, anticorps Rab18, anticorps rab18, anticorps LOC100219058, anticorps rab-18, anticorps rab18.S, anticorps rab18b, anticorps rab18a

Sujet: Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

UniProt: Q9NP72

Pathways: SARS-CoV-2 Protein Interactome