SP5 anticorps

N° du produit ABIN4952680

Détail du produit anti-SP5 anticorps

Antigène: SP5 (Sp5 Transcription Factor (SP5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SP5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Sp5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Sp5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SP5

Antigène: SP5 (Sp5 Transcription Factor (SP5))

Autre désignation: Sp5 (SP5 Produits)

Synonymes: anticorps bts1, anticorps fc39b01, anticorps wu:fc39b01, anticorps Bricd6, anticorps SP-C, anticorps SP5, anticorps SPC, anticorps Sftp-2, anticorps Sftp2, anticorps pro-SpC, anticorps Sp5 transcription factor, anticorps Sp5 transcription factor a, anticorps surfactant associated protein C, anticorps trans-acting transcription factor 5, anticorps Sp5, anticorps sp5a, anticorps SP5, anticorps CpipJ_CPIJ003609, anticorps Sftpc

Sujet: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

UniProt: Q6BEB4