Unc5c anticorps

N° du produit ABIN4953027

Détail du produit anti-Unc5c anticorps

Antigène: Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Unc5c est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the UNC5C antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the UNC5C antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Unc5c

Antigène: Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))

Autre désignation: UNC5C (Unc5c Produits)

Synonymes: anticorps UNC5C, anticorps UNC5H3, anticorps 6030473H24, anticorps AI047720, anticorps B130051O18Rik, anticorps Unc5h3, anticorps rcm, anticorps wu:fb03d07, anticorps unc-5 netrin receptor C, anticorps UNC5C, anticorps Unc5c, anticorps unc5c

Sujet: Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

UniProt: O95185