JAK1 anticorps (N-Term)

N° du produit ABIN5518768

Détail du produit anti-JAK1 anticorps

Antigène: JAK1 (Janus Kinase 1 (JAK1))

Épitope: AA 78-115, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JAK1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: FALYDENTKL WYAPNRTITV DDKMSLRLHY RMRFYFTN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Janus kinase 1
Protein Name: Tyrosine-protein kinase JAK1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-JAK1 (ABIN5518768)

Liu, Li, Liang, Li, Jiang, Chu, Yang: "Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." dans: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).

Détails sur JAK1

Antigène: JAK1 (Janus Kinase 1 (JAK1))

Autre désignation: JAK1 (JAK1 Produits)

Synonymes: anticorps JAK1A, anticorps JAK1B, anticorps JTK3, anticorps AA960307, anticorps C130039L05Rik, anticorps wu:fb93e10, anticorps jak1, anticorps Janus kinase 1, anticorps tyrosine-protein kinase JAK1, anticorps JAK1, anticorps Jak1, anticorps jak1, anticorps LOC100286690

Sujet: JAK1 (JANUS KINASE 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-α/β) and type II (IFN-γ) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

Synonyms: JAK 1A | JAK-1 | JAK1A | JAK1B | Tyrosineprotein kinase JAK1 | Tyrosine-protein kinase JAK1 | P23458

ID gène: 3716

UniProt: P23458

Pathways: Signalistation JAK/STAT, Signalisation RTK, Interferon-gamma Pathway, Hepatitis C, Toll-Like Receptors Cascades, Unfolded Protein Response