MC3R anticorps (N-Term)

N° du produit ABIN5518775

Détail du produit anti-MC3R anticorps

Antigène: MC3R (Melanocortin 3 Receptor (MC3R))

Épitope: AA 91-121, N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MC3R est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Melanocortin receptor 3(MC3R) detection. Tested with WB in Human,Mouse.

Séquence: NALETIMIAI VHSDYLTFED QFIQHMDNIF D

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Melanocortin receptor 3(MC3R) detection. Tested with WB in Human,Mouse.
Gene Name: melanocortin 3 receptor
Protein Name: Melanocortin receptor 3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human MC3 Receptor (91-121aa NALETIMIAIVHSDYLTFEDQFIQHMDNIFD), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MC3R

Antigène: MC3R (Melanocortin 3 Receptor (MC3R))

Autre désignation: MC3R (MC3R Produits)

Synonymes: anticorps zgc:194235, anticorps MC3-R, anticorps BMIQ9, anticorps MC3, anticorps OB20, anticorps OQTL, anticorps melanocortin 3 receptor, anticorps mc3r, anticorps MC3R, anticorps Mc3r

Sujet: Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.

Synonyms: BMIQ9 | MC3 | MC3 R | MC3-R | Mc3r | OB20 | OQTL | P41968

ID gène: 4159

UniProt: P41968

Pathways: cAMP Metabolic Process