MMP11 anticorps (N-Term)

N° du produit ABIN5518777

Détail du produit anti-MMP11 anticorps

Antigène: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Épitope: AA 104-135, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP11 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: RWEKTDLTYR ILRFPWQLVQ EQVRQTMAEA LK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: matrix metallopeptidase 11
Protein Name: Stromelysin-3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-MMP11 (ABIN5518777)

Zhang, Teng, Liu, Zhang, Liu: "Gene expression profile analyze the molecular mechanism of CXCR7 regulating papillary thyroid carcinoma growth and metastasis." dans: Journal of experimental & clinical cancer research : CR, Vol. 34, pp. 16, (2015) (PubMed).

Détails sur MMP11

Antigène: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Autre désignation: MMP11 (MMP11 Produits)

Synonymes: anticorps SL-3, anticorps ST3, anticorps STMY3, anticorps Stmy3, anticorps MMP-11, anticorps matrix metallopeptidase 11, anticorps matrix metallopeptidase 11 L homeolog, anticorps stromelysin-3, anticorps MMP11, anticorps Mmp11, anticorps mmp11.L, anticorps LOC103694874

Sujet: Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.

Synonyms: MMP-11 | Mmp11 | SL 3 | SL-3 | SL3 | ST3 | STMY3 | Stromelysin 3 | Stromelysin III | Stromelysin-3 | P24347

ID gène: 4320

UniProt: P24347