FDCSP anticorps (Middle Region)

N° du produit ABIN5518833

Détail du produit anti-FDCSP anticorps

Antigène: FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))

Épitope: AA 18-51, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FDCSP est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Follicular dendritic cell secreted peptide(FDCSP) detection. Tested with IHC-P in Human.

Séquence: FPVSQDQERE KRSISDSDEL ASGFFVFPYP YPFR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Follicular dendritic cell secreted peptide(FDCSP) detection. Tested with IHC-P in Human.
Gene Name: follicular dendritic cell secreted protein
Protein Name: Follicular dendritic cell secreted peptide

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).

Isotype: IgG

Information d'application

Indications d'application: IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur FDCSP

Antigène: FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))

Autre désignation: FDCSP (C4orf7 Produits)

Synonymes: anticorps FDC-SP, anticorps C4orf7, anticorps cDNA sequence BC037156, anticorps follicular dendritic cell secreted protein, anticorps BC037156, anticorps FDCSP

Sujet: FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.

Synonyms: C4orf7 | FDC-SP | FDCSP | Q8NFU4

ID gène: 260436