PTGER4 anticorps (C-Term)

N° du produit ABIN5518866

Détail du produit anti-PTGER4 anticorps

Antigène: PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))

Épitope: AA 311-345, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTGER4 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Prostaglandin E2 receptor EP4 subtype(PTGER4) detection. Tested with WB in Human.

Séquence: DLQAIRIASV NPILDPWIYI LLRKTVLSKA IEKIK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Prostaglandin E2 receptor EP4 subtype(PTGER4) detection. Tested with WB in Human.
Gene Name: prostaglandin E receptor 4
Protein Name: Prostaglandin E2 receptor EP4 subtype

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PTGER4

Antigène: PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))

Autre désignation: PTGER4 (PTGER4 Produits)

Synonymes: anticorps EP4, anticorps PGE2R-EP4, anticorps ptger4, anticorps ptger4l, anticorps PTGER4, anticorps EP4R, anticorps Ptgerep4, anticorps Ptger, anticorps ep4, anticorps prostaglandin E receptor 4, anticorps prostaglandin E receptor 4 (subtype EP4), anticorps prostaglandin E receptor 4 (subtype EP4) a, anticorps prostaglandin E receptor 4 subtype EP4, anticorps PTGER4, anticorps ptger4a, anticorps ptger4, anticorps Ptger4

Sujet: Prostaglandin E2 receptor 4 (EP4) is a prostaglandin receptor encoded by the PTGER4 gene in humans. The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses.

Synonyms: EP 4 | EP4 | EP4R | PTGER 2 | PTGER2 | PTGER 4 | PTGER4 | P35408

ID gène: 5734

UniProt: P35408