PPARG anticorps (Middle Region)

N° du produit ABIN5518944

Détail du produit anti-PPARG anticorps

Antigène: PPARG (Peroxisome Proliferator-Activated Receptor gamma (PPARG))

Épitope: AA 207-248, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPARG est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Peroxisome proliferator-activated receptor gamma(PPARG) detection. Tested with WB in Human,Mouse,Rat.

Séquence: AIRFGRMPQA EKEKLLAEIS SDIDQLNPES ADLRALAKHL YD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Peroxisome proliferator-activated receptor gamma(PPARG) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: peroxisome proliferator activated receptor gamma
Protein Name: Peroxisome proliferator-activated receptor gamma

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human PPAR gamma (207-248aa AIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYD), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-PPARG (ABIN5518944)

Yang, Fu, Hu, Luo, Hu, Wang: "PIK3R3 regulates PPARα expression to stimulate fatty acid β-oxidation and decrease hepatosteatosis." dans: Experimental & molecular medicine, Vol. 50, Issue 1, pp. e431, (2018) (PubMed).

Wu, Wu, Jiao, Wang, Wang, Zhang: "Rosiglitazone infusion therapy following minimally invasive surgery for intracerebral hemorrhage evacuation decreases matrix metalloproteinase-9 and blood-brain barrier disruption in rabbits." dans: BMC neurology, Vol. 15, pp. 37, (2016) (PubMed).

Chen, Bai, Liao, Peng, Wu, Wang, Zeng, Xie: "Electrospun poly(L-lactide)/poly(?-caprolactone) blend nanofibrous scaffold: characterization and biocompatibility with human adipose-derived stem cells." dans: PLoS ONE, Vol. 8, Issue 8, pp. e71265, (2013) (PubMed).

Wang, Liu, Dang, Ma, Zhang, Wang: "The effect of core decompression on local expression of BMP-2, PPAR-γ and bone regeneration in the steroid-induced femoral head osteonecrosis." dans: BMC musculoskeletal disorders, Vol. 13, pp. 142, (2012) (PubMed).

Xie, Wang, Zhang, Li, Can, Qing, Kung, Zhang: "Enhanced peroxisomal ?-oxidation metabolism in visceral adipose tissues of high-fat diet-fed obesity-resistant C57BL/6 mice." dans: Experimental and therapeutic medicine, Vol. 2, Issue 2, pp. 309-315, (2012) (PubMed).

Xie, Zhao, Gu, Du, Cai, Zhang: "Scorpion in Combination with Gypsum: Novel Antidiabetic Activities in Streptozotocin-Induced Diabetic Mice by Up-Regulating Pancreatic PPARγ and PDX-1 Expressions." dans: Evidence-based complementary and alternative medicine : eCAM, Vol. 2011, pp. 683561, (2011) (PubMed).

Détails sur PPARG

Antigène: PPARG (Peroxisome Proliferator-Activated Receptor gamma (PPARG))

Autre désignation: PPARG (PPARG Produits)

Synonymes: anticorps PPAR gamma, anticorps PPARg2, anticorps PPARG, anticorps Nr1c3, anticorps PPAR-gamma, anticorps PPAR-gamma2, anticorps PPARgamma, anticorps PPARgamma2, anticorps NR1C3, anticorps CIMT1, anticorps GLM1, anticorps PPARG1, anticorps PPARG2, anticorps xPPAR-gamma, anticorps PPAR-GAMMA, anticorps PPARGAMMA, anticorps peroxisome proliferator-activated receptor gamma, anticorps peroxisome proliferator activated receptor gamma, anticorps peroxisome proliferator activated receptor gamma L homeolog, anticorps PPARG, anticorps Pparg, anticorps pparg.L

Sujet: The peroxisome proliferator-activated receptors (PPARs) are a group of three nuclear receptor isoforms, PPAR gamma, PPAR alpha, and PPAR delta, encoded by different genes. PPARs are ligand-regulated transcription factors that control gene expression by binding to specific response elements (PPREs) within promoters. PPAR gamma is a transcription factor that has a pivotal role in adipocyte differentiation and expression of adipocyte-specific genes. The PPAR gamma1 and gamma2 isoforms result from alternative splicing and have ligand-dependent and -independent activation domains. PPAR gamma is a member of a family of nuclear receptors/ligand-dependent transcription factors, which bind to hormone response elements on target gene promoters. PPAR gamma is abundantly expressed in normal lung tissues, especially in endothelial cells, but that its expression is reduced or absent in the angiogenic plexiform lesions of pulmonary hypertensive lungs and in the vascular lesions of a rat model of severe pulmonary hypertension. And it is concluded that fluid shear stress decreases the expression of PPARgamma in endothelial cells and that loss of PPARgamma expression characterizes an abnormal, proliferating, apoptosis-resistant endothelial cell phenotype.

Synonyms: Peroxisome proliferator-activated receptor gamma, PPAR-gamma, Nuclear receptor subfamily 1 group C member 3, PPARG, NR1C3

ID gène: 5468

UniProt: P37231

Pathways: Signalisation MAPK, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Endopeptidase Activity, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation