FUS anticorps

N° du produit ABIN5518993

Détail du produit anti-FUS anticorps

Antigène: FUS (Fused in Sarcoma (FUS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FUS est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for TLS / FUS detection. Tested with WB in Human,Mouse,Rat.

Séquence: DNNTIFVQGL GENVTIESVA DYFKQIGIIK TNKKT

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for TLS / FUS detection. Tested with WB in Human,Mouse,Rat.
Gene Name: FUS RNA binding protein
Protein Name: RNA-binding protein FUS

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT).

Isotype: IgG

Information d'application

Indications d'application: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur FUS

Antigène: FUS (Fused in Sarcoma (FUS))

Autre désignation: FUS (FUS Produits)

Synonymes: anticorps ALS6, anticorps ETM4, anticorps FUS1, anticorps HNRNPP2, anticorps POMP75, anticorps TLS, anticorps D430004D17Rik, anticorps D930039C12Rik, anticorps Fus1, anticorps Tls, anticorps FUS/TLS, anticorps FUS RNA binding protein, anticorps fused in sarcoma, anticorps FUS, anticorps Fus

Classe de substances: Viral Protein

Sujet: RNA-binding protein FUS/TLS (Fused in Sarcoma/Translocated in Sarcoma) is a protein that in humans is encoded by the FUS gene. This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Synonyms: RNA-binding protein FUS, 75 kDa DNA-pairing protein, Oncogene FUS, Oncogene TLS, POMp75, Translocated in liposarcoma protein, FUS, TLS

ID gène: 2521

UniProt: P35637