JAK1 anticorps (AA 78-115)

N° du produit ABIN5647398

Cet anticorps Lapin Polyclonal détecte spécifiquement JAK1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour JAK1 anticorps (AA 78-115) (ABIN5647398)

Antigène: JAK1 (Janus Kinase 1 (JAK1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JAK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-JAK1 anticorps

Épitope: AA 78-115

Purification: Antigen affinity purified

Immunogène: Amino acids 78-115 (FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN) from the human protein were used as the immunogen for the JAK1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the JAK1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the JAK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur JAK1

Antigène: JAK1 (Janus Kinase 1 (JAK1))

Autre désignation: JAK1

Sujet: JAK1 (Janus Kinase 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-a/b) and type II (IFN-g) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

UniProt: P23458

Pathways: Signalistation JAK/STAT, Signalisation RTK, Interferon-gamma Pathway, Hepatitis C, Toll-Like Receptors Cascades, Unfolded Protein Response