AKR1B10 anticorps (AA 285-316)

N° du produit ABIN5647462

Détail du produit anti-AKR1B10 anticorps

Antigène: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Épitope: AA 285-316

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKR1B10 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 285-316 (EMATILSFNRNWRACNVLQSSHLEDYPFNAEY) from the human protein were used as the immunogen for the AKR1B10 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the AKR1B10 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the AKR1B10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur AKR1B10

Antigène: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Autre désignation: AKR1B10 (AKR1B10 Produits)

Synonymes: anticorps AKR1B11, anticorps AKR1B12, anticorps ALDRLn, anticorps ARL-1, anticorps ARL1, anticorps HIS, anticorps HSI, anticorps 2310005E10Rik, anticorps Akr1b16, anticorps AKR, anticorps AKR1B10, anticorps Akr1b10, anticorps aldo-keto reductase family 1 member B10, anticorps aldo-keto reductase family 1, member B10 (aldose reductase), anticorps aldo-keto reductase family 1 member B10-like 2, anticorps AKR1B10, anticorps Akr1b10, anticorps AKR1B10L2, anticorps LOC100585902, anticorps LOC100723118, anticorps LOC101107697

Sujet: Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

UniProt: O60218