IBSP anticorps

N° du produit ABIN5647643

Détail du produit anti-IBSP anticorps

Antigène: IBSP (Integrin-Binding Sialoprotein (IBSP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IBSP est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ were used as the immunogen for the IBSP antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IBSP antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IBSP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur IBSP

Antigène: IBSP (Integrin-Binding Sialoprotein (IBSP))

Autre désignation: IBSP / Bone Sialoprotein 2 (IBSP Produits)

Synonymes: anticorps BNSP, anticorps BSP, anticorps BSP-II, anticorps SP-II, anticorps Bsp, anticorps BSP II, anticorps BSPII, anticorps Bsp2, anticorps IBSP, anticorps integrin binding sialoprotein, anticorps integrin-binding sialoprotein, anticorps integrin-binding sialoprotein S homeolog, anticorps IBSP, anticorps Ibsp, anticorps ibsp.S, anticorps ibsp

Sujet: IBSP (integrin-binding sialoprotein) is also known as BSP. The protein encoded by this gene is a major structural protein of the bone matrix. Bone sialoprotein is an acidic glycoprotein of approximately 70 kD that undergoes extensive posttranslational modifications. It constitutes approximately 12 % of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor. The BSP gene is mapped to 4q22.1.

UniProt: P21815