HMGB2 anticorps

N° du produit ABIN5647796

Détail du produit anti-HMGB2 anticorps

Antigène: HMGB2 (High Mobility Group Box 2 (HMGB2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGB2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR were used as the immunogen for the HMGB2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: Prior to reconstitution, store at 4°C. After reconstitution, the HMGB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HMGB2

Antigène: HMGB2 (High Mobility Group Box 2 (HMGB2))

Autre désignation: HMGB2 (HMGB2 Produits)

Synonymes: anticorps HMG2, anticorps C80539, anticorps HMG-2, anticorps Hmg2, anticorps HIGH MOBILITY GROUP BETA 1, anticorps HMG BETA 1, anticorps NFD02, anticorps NFD2, anticorps NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, anticorps NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, anticorps high mobility group B2, anticorps hmgb2, anticorps hmgb2l, anticorps im:6909096, anticorps wu:fa20b02, anticorps zgc:101854, anticorps wu:fb22b10, anticorps wu:fc95d12, anticorps zgc:123215, anticorps high mobility group box 2, anticorps high mobility group box 2 S homeolog, anticorps high mobility group B2, anticorps high mobility group box 2b, anticorps high mobility group box 2a, anticorps HMGB2, anticorps Hmgb2, anticorps hmgb2.S, anticorps hmgb2b, anticorps hmgb2a

Sujet: High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

UniProt: P26583

Pathways: Cellular Response to Molecule of Bacterial Origin