ITLN1/Omentin anticorps

N° du produit ABIN5647892

Détail du produit anti-ITLN1/Omentin anticorps

Antigène: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITLN1/Omentin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR were used as the immunogen for the ITLN1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: Prior to reconstitution, store at 4°C. After reconstitution, the ITLN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ITLN1/Omentin

Antigène: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Autre désignation: ITLN1 / Intelectin-1 (ITLN1 Produits)

Synonymes: anticorps IntL, anticorps Itln, anticorps Itln2, anticorps Itln5, anticorps Itlna, anticorps Lfr, anticorps HL-1, anticorps HL1, anticorps INTL, anticorps ITLN, anticorps LFR, anticorps hIntL, anticorps omentin, anticorps LfR, anticorps Xeel, anticorps hl-1, anticorps hl1, anticorps intl, anticorps itln, anticorps itln1, anticorps lfr, anticorps xeel, anticorps INTL1, anticorps zgc:153267, anticorps intelectin 1 (galactofuranose binding), anticorps intelectin 1, anticorps intelectin 1 L homeolog, anticorps Itln1, anticorps ITLN1, anticorps itln1.L, anticorps itln1

Sujet: Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.

UniProt: Q8WWA0