CRTC2 anticorps

N° du produit ABIN5692828

Détail du produit anti-CRTC2 anticorps

Antigène: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRTC2 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: EKIALQKQRQ AEETAAFEEV MMDIGSTRLQ AQKLRLAYTR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for TORC2 detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human TORC2 (EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur CRTC2

Antigène: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Autre désignation: CRTC2 (CRTC2 Produits)

Synonymes: anticorps CRTC2, anticorps TORC-2, anticorps TORC2, anticorps 4632407F12Rik, anticorps Torc2, anticorps mTORC2, anticorps RGD1308903, anticorps CREB regulated transcription coactivator 2, anticorps CRTC2, anticorps Crtc2

Sujet:

Synonyms: CREB-regulated transcription coactivator 2, Transducer of regulated cAMP response element-binding protein 2, TORC-2, Transducer of CREB protein 2, CRTC2, TORC2

Tissue Specificity: Most abundantly expressed in the thymus. Present in both B and T-lymphocytes. Highly expressed in HEK293T cells and in insulinomas. High levels also in spleen, ovary, muscle and lung, with highest levels in muscle. Lower levels found in brain, colon, heart, kidney, prostate, small intestine and stomach. Weak expression in liver and pancreas.

Background: CREB regulated transcription coactivator 2, also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.

Pathways: AMPK Signaling, Carbohydrate Homeostasis