SOD3 anticorps

N° du produit ABIN5692939

Détail du produit anti-SOD3 anticorps

Antigène: SOD3 (Superoxide Dismutase 3, Extracellular (SOD3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SOD3 est non-conjugé

Application: Immunohistochemistry (IHC)

Marque: Picoband™

Séquence: WTGEDSAEPN SDSAEWIRDM YAKVTEIWQE VMQRRDDD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for SOD3 detection. Tested with IHC-P in Human

Immunogène: A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD).

Information d'application

Indications d'application:

Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-SOD3 (ABIN5692939)

Li, Xiao, Li, Li, Zeng, Liu, Liang, Li, Chu, Yang: "Hydrogen sulfide reduced renal tissue fibrosis by regulating autophagy in diabetic rats." dans: Molecular medicine reports, Vol. 16, Issue 2, pp. 1715-1722, (2018) (PubMed).

Détails sur SOD3

Antigène: SOD3 (Superoxide Dismutase 3, Extracellular (SOD3))

Autre désignation: SOD3 (SOD3 Produits)

Synonymes: anticorps EC-SOD, anticorps ECSOD, anticorps SOD3, anticorps AI314465, anticorps LOC780439, anticorps fb05f10, anticorps si:dkey-117m1.6, anticorps sod3, anticorps wu:fb05f10, anticorps ECSODPT, anticorps CuZnSOD, anticorps SODA.4, anticorps superoxide dismutase 3, anticorps superoxide dismutase 3, extracellular, anticorps superoxide dismutase 3, extracellular b, anticorps superoxide dismutase 1, anticorps superoxide dismutase precursor ,putative, anticorps SOD3, anticorps Sod3, anticorps sod3b, anticorps sod3, anticorps Sod1, anticorps Smp_095980

Sujet:

Synonyms: Extracellular superoxide dismutase [Cu-Zn], EC-SOD, 1.15.1.1, SOD3

Tissue Specificity: Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.

Background: SOD3 (SUPEROXIDE DISMUTASE 3), also called SUPEROXIDE DISMUTASE, EXTRACELLULAR, EC-SOD, and Cu-Zn, is an enzyme that in humans is encoded by the SOD3 gene. This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. Hendrickson et al. (1990) mapped the SOD3 gene to 4pter-q21 by a study of somatic cell hybrids. Stern et al. (2003) narrowed the assignment to 4p15.3-p15.1 by somatic cell and radiation hybrid analysis, linkage mapping, and FISH. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM.

UniProt: P08294