KLF4 anticorps

N° du produit ABIN5693240

Détail du produit anti-KLF4 anticorps

Antigène: KLF4 (Kruppel-Like Factor 4 (Gut) (KLF4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLF4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Marque: Picoband™

Séquence: EKTLRQAGAP NNRWREELSH MKRLPPVLPG RPYDLA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for KLF4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human KLF4 (EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLA).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-KLF4 (ABIN5693240)

Ai, Shao, Shi, Yu, Wu, Du, Zhang, Guo: "Maintenance of Self-Renewal and Pluripotency in J1 Mouse Embryonic Stem Cells through Regulating Transcription Factor and MicroRNA Expression Induced by PD0325901." dans: Stem cells international, Vol. 2016, pp. 1792573, (2016) (PubMed).

Ai, Shao, Wu, Yu, Du, Shi, Shi, Zhang, Guo: "CHIR99021 enhances Klf4 Expression through β-Catenin Signaling and miR-7a Regulation in J1 Mouse Embryonic Stem Cells." dans: PLoS ONE, Vol. 11, Issue 3, pp. e0150936, (2016) (PubMed).

Détails sur KLF4

Antigène: KLF4 (Kruppel-Like Factor 4 (Gut) (KLF4))

Autre désignation: KLF4 (KLF4 Produits)

Synonymes: anticorps EZF, anticorps GKLF, anticorps Gklf, anticorps Zie, anticorps KLF4, anticorps biklf, anticorps biklf-A, anticorps Kruppel like factor 4, anticorps Kruppel-like factor 4 (gut), anticorps Kruppel-like factor 4, anticorps Kruppel-like factor 4 (gut) L homeolog, anticorps KLF4, anticorps Klf4, anticorps klf4, anticorps klf4.L

Sujet:

Synonyms: Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor, KLF4, EZF, GKLF

Background: Kruppel-like factor 4, also known as EZF or GKLF, is a protein that in humans is encoded by the KLF4 gene. This gene is mapped to 9q31.2. KLF4 gene encodes a member of the Kruppel family of transcription factors. This gene plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. It is required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. This gene involved in the differentiation of epithelial cells and may also function in skeletal and kidney development.

UniProt: O43474

Pathways: Peptide Hormone Metabolism, Stem Cell Maintenance