KCNH1 anticorps

N° du produit ABIN5693254

Détail du produit anti-KCNH1 anticorps

Antigène: KCNH1 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 1 (KCNH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNH1 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: AKRKSWARFK DACGKSEDWN KVSKAESMET LPERTKA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for KCNH1 detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur KCNH1

Antigène: KCNH1 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 1 (KCNH1))

Autre désignation: KCNH1 (KCNH1 Produits)

Synonymes: anticorps EAG, anticorps bEAG, anticorps EAG1, anticorps Kv10.1, anticorps h-eag, anticorps M-eag, anticorps Eag1, anticorps kcnh1, anticorps potassium voltage-gated channel subfamily H member 1, anticorps potassium channel, voltage gated eag related subfamily H, member 1, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 1, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 1a, anticorps KCNH1, anticorps LOC490277, anticorps Kcnh1, anticorps kcnh1a

Sujet:

Synonyms: Potassium voltage-gated channel subfamily H member 1, Ether-a-go-go potassium channel 1

Tissue Specificity: Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.

Background: Potassium voltage-gated channel subfamily H member 1 is a protein that in humans is encoded by the KCNH1 gene. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.

UniProt: O95259