Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

FLT1 anticorps

FLT1 Reactivité: Humain, Rat, Souris WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN5693264
  • Antigène Voir toutes FLT1 Anticorps
    FLT1 (Fms-Related tyrosine Kinase 1 (VEGFR1) (FLT1))
    Reactivité
    • 144
    • 66
    • 65
    • 12
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Rat, Souris
    Hôte
    • 141
    • 32
    • 3
    • 1
    Lapin
    Clonalité
    • 142
    • 35
    Polyclonal
    Conjugué
    • 93
    • 22
    • 11
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp FLT1 est non-conjugé
    Application
    • 111
    • 49
    • 44
    • 36
    • 23
    • 23
    • 21
    • 15
    • 14
    • 13
    • 8
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Séquence
    DPELSLKGTQ HIMQAGQTLH LQCRGEAAHK WSLPEMVSKE
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for VEGF Receptor 1 detection. Tested with WB in Human,Mouse,Rat.
    Immunogène
    A synthetic peptide corresponding to a sequence of human VEGF Receptor 1 (DPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKE).
    Top Product
    Discover our top product FLT1 Anticorps primaire
  • Indications d'application

    Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

    Application Details: Western blot, 0.1-0.5 μg/mL

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Buffer
    Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
  • Liu, Kuang, Wu, Jin, Sun: "A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." dans: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).

    Wu, You, Ma, Li, Yuan, Li, Ye, Liu, Yao, Chen, Lai, Yang: "Role of transient receptor potential ion channels and evoked levels of neuropeptides in a formaldehyde-induced model of asthma in BALB/c mice." dans: PLoS ONE, Vol. 8, Issue 5, pp. e62827, (2013) (PubMed).

  • Antigène
    FLT1 (Fms-Related tyrosine Kinase 1 (VEGFR1) (FLT1))
    Autre désignation
    FLT1 (FLT1 Produits)
    Synonymes
    anticorps FLT, anticorps FLT-1, anticorps VEGFR-1, anticorps VEGFR1, anticorps FLT1, anticorps flt1b, anticorps sFlt1, anticorps AI323757, anticorps Flt-1, anticorps fms related tyrosine kinase 1, anticorps FMS-related tyrosine kinase 1, anticorps vascular endothelial growth factor receptor 1, anticorps fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor), anticorps FMS-like tyrosine kinase 1, anticorps vascular endothelial growth factor receptor-1, anticorps FLT1, anticorps Flt1, anticorps CpipJ_CPIJ012087, anticorps flt1, anticorps FLT-1
    Sujet

    Synonyms: Vascular endothelial growth factor receptor 1, VEGFR-1, Fms-like tyrosine kinase 1, FLT-1, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, FLT, Vascular permeability factor receptor, FLT1, FLT, FRT, VEGFR1

    Tissue Specificity: Detected in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform 2 is strongly expressed in placenta. Isoform 3 is expressed in corneal epithelial cells (at protein level). Isoform 3 is expressed in vascular smooth muscle cells (VSMC).

    Background: Vascular endothelial growth factor receptor 1 (FLT1) is a protein that in humans is encoded by the FLT1 gene. Oncogene FLT belongs to the src gene family. It is mapped to 13q12. The deduced 1,338-amino acid protein has a calculated molecular mass of 150.6 kD. It has a 758-amino acid extracellular domain, followed by a 22-amino acid transmembrane region and a 558-amino acid cytoplasmic region containing a cluster of basic amino acids and a tyrosine kinase domain. sFLT-1 was identified in placenta, adult lung, kidney, liver and uterus. Like other members of this family, it shows tyrosine protein kinase activity that is important for the control of cell proliferation and differentiation.

    UniProt
    P17948
    Pathways
    Signalisation RTK, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
Vous êtes ici:
Support technique