PSMA3 anticorps (AA 88-127)

N° du produit ABIN5708104

Détail du produit anti-PSMA3 anticorps

Antigène: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Épitope: AA 88-127

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 88-127 (LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS) from the human protein were used as the immunogen for the PSMA3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PSMA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PSMA3

Antigène: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Autre désignation: PSMA3 (PSMA3 Produits)

Synonymes: anticorps HC8, anticorps PSC3, anticorps Psma3l, anticorps psma3, anticorps im:6909944, anticorps zgc:114044, anticorps Lmpc8, anticorps proteasome subunit alpha 3, anticorps proteasome subunit alpha 3 L homeolog, anticorps proteasome (prosome, macropain) subunit, alpha type 3, anticorps PSMA3, anticorps Psma3, anticorps psma3.L, anticorps psma3

Sujet: Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

UniProt: P25788

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA