CRTC2 anticorps

N° du produit ABIN5708213

Détail du produit anti-CRTC2 anticorps

Antigène: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRTC2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR were used as the immunogen for the TORC2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the TORC2 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the TORC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CRTC2

Antigène: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Autre désignation: TORC2 / CRTC2 (CRTC2 Produits)

Synonymes: anticorps CRTC2, anticorps TORC-2, anticorps TORC2, anticorps 4632407F12Rik, anticorps Torc2, anticorps mTORC2, anticorps RGD1308903, anticorps CREB regulated transcription coactivator 2, anticorps CRTC2, anticorps Crtc2

Sujet: TORC2 (Transducer of CREB protein 2), also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.

UniProt: Q53ET0

Pathways: AMPK Signaling, Carbohydrate Homeostasis