PEBP1 anticorps

N° du produit ABIN5708350

Détail du produit anti-PEBP1 anticorps

Antigène: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEBP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ were used as the immunogen for the RKIP antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the RKIP antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the RKIP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PEBP1

Antigène: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Autre désignation: RKIP / PEBP1 / PBP (PEBP1 Produits)

Synonymes: anticorps HCNP, anticorps HCNPpp, anticorps PBP, anticorps PEBP, anticorps PEBP-1, anticorps RKIP, anticorps pbp, anticorps hcnp, anticorps pebp, anticorps rkip, anticorps Pbp, anticorps Pbp1, anticorps Pbpr, anticorps Rkip, anticorps PEBP1, anticorps BcDNA:LP12095, anticorps CG18594, anticorps Dmel\\CG18594, anticorps T2, anticorps zgc:56033, anticorps zgc:76942, anticorps phosphatidylethanolamine binding protein 1, anticorps phosphatidylethanolamine binding protein 1 L homeolog, anticorps phosphatidylethanolamine-binding protein, anticorps phosphatidylethanolamine-binding protein,putative, anticorps Phosphatidylethanolamine-binding protein 1, anticorps PEBP1, anticorps pebp1, anticorps Pebp1, anticorps pebp1.L, anticorps RR_RS07785, anticorps PVX_235290, anticorps PVX_123630, anticorps PKH_143640, anticorps EAM_1207

Sujet: PEBP1 (Phosphatidylethanolamine-binding protein 1), also called PBP, RKIP, inhibits the phosphorylation and activation of MEK by RAF1. PEBP1 is identical to the phosphatidylethanolamine-binding protein (PBP) with a relative molecular mass of 23 kD. The PEBP1 gene is mapped on 12q24.23. PEBP1 coimmunoprecipitates with RAF1 and MEK from cell lysates and colocalizes with RAF1 when examined by confocal microscopy. PEBP1 overexpression interferes with the activation of MEK and ERK, induction of AP1-dependent reporter genes, and transformation elicited by an oncogenically activated RAF1 kinase. PEBP1 expression was rapidly upregulated during induction of chemotherapy-triggered apoptosis in human prostate and breast cancer cell lines, and maximal RKIP expression correlated perfectly with the onset of apoptosis by Chatterjee et al (2004). RKIP depletion decreased the mitotic index, the number of metaphase cells, traversal times from nuclear envelope breakdown to anaphase, and an override of mitotic checkpoints induced by spindle poisons.

UniProt: P30086

Pathways: Feeding Behaviour