CHRNA3 anticorps

N° du produit ABIN5708503

Détail du produit anti-CHRNA3 anticorps

Antigène: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHRNA3 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Purification: Antigen affinity purified

Immunogène: Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CHRNA3 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CHRNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CHRNA3

Antigène: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Autre désignation: CHRNA3 (CHRNA3 Produits)

Synonymes: anticorps LNCR2, anticorps NACHRA3, anticorps PAOD2, anticorps (a)3, anticorps A730007P14Rik, anticorps Acra-3, anticorps Acra3, anticorps cholinergic receptor nicotinic alpha 3 subunit, anticorps cholinergic receptor, nicotinic, alpha polypeptide 3, anticorps CHRNA3, anticorps Chrna3

Sujet: After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt]

UniProt: P32297

Pathways: Synaptic Membrane