LYZL6 anticorps

N° du produit ABIN599863

Détail du produit anti-LYZL6 anticorps

Antigène: LYZL6 (Lysozyme-Like 6 (LYZL6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYZL6 est non-conjugé

Application: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificité: Recognizes human Lysozyme-like 6.

Homologie: Percent identity by BLAST analysis: Human, Gorilla (100%) Gibbon (97%) Monkey, Marmoset (90%).

Purification: Immunoaffinity purified

Immunogène: Lysozyme-like protein 6 Precursor recombinant protein epitope signature tag (PrEST), immunogen sequence CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP. Percent identity by BLAST analysis: Human, Gorilla (100%), Gibbon (97%), Monkey, Marmoset (90%).

Type of Immunogen: Recombinant protein

Isotype: IgG

Information d'application

Indications d'application: Approved: IHC, IHC-P

Usage: Suitable for use in Immunohistochemistry: Formalin-fixed, paraffin-embedded sections. Most normal tissues and malignant tissues were negative. Subsets of cells in seminiferous ducts expressed strong cytoplasmic positivity while the urothelium displayed moderate staining. Placenta, some of the glandular cells in gastrointestinal tract, epididymis and seminal vesicles showed weak staining. Occasional malignant carcinoids, urothelial and colorectal cancers showed weak to moderate staining.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS,  pH 7.2, 40 % glycerol, 0.02 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: May be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 1 year at -20°C.

Détails sur LYZL6

Antigène: LYZL6 (Lysozyme-Like 6 (LYZL6))

Autre désignation: LYZL6 (LYZL6 Produits)

Synonymes: anticorps LYC1, anticorps PRO1485, anticorps TKAL754, anticorps UNQ754, anticorps 1700023H08Rik, anticorps Lyc1, anticorps RGD1306968, anticorps lysozyme like 6, anticorps lysozyme-like protein 6, anticorps lysozyme-like 6, anticorps LYZL6, anticorps LOC480492, anticorps Lyzl6

Sujet: Name/Gene ID: LYZL6

Synonyms: LYZL6, LYC1, Lysozyme homolog, PRO1485, Lysozyme-like 6, Lysozyme-like protein 6, TKAL754, UNQ754

ID gène: 57151

UniProt: O75951