Spermidine Synthase anticorps (Internal Region)

N° du produit ABIN6265256

Détail du produit anti-Spermidine Synthase anticorps

Antigène: Spermidine Synthase (SRM)

Épitope: Internal Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Spermidine Synthase est non-conjugé

Application: Western Blotting (WB), ELISA

Séquence: MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS

Specificité: SPEE Antibody detects endogenous levels of total SPEE.

Homologie: Pig,Zebrafish,Bovine,Horse,Sheep,Dog,Chicken,Xenopus

Purification: The antiserum was purified by peptide affinity chromatography using SulfoLink^TM Coupling Resin (Thermo Fisher Scientific).

Immunogène: A synthesized peptide derived from human SPEE, corresponding to a region within the internal amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB 1:1000-3000, ELISA(peptide) 1:20000-1:40000

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: Rabbit IgG in phosphate buffered saline , pH 7.4, 150 mM NaCl, 0.02 % sodium azide and 50 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: Store at -20 °C. Stable for 12 months from date of receipt.

Date de péremption: 12 months

Détails sur Spermidine Synthase

Antigène: Spermidine Synthase (SRM)

Autre désignation: SRM (SRM Produits)

Synonymes: anticorps PAPT, anticorps SPDSY, anticorps SPS1, anticorps SRML1, anticorps AA407669, anticorps SpdST, anticorps SpdSy, anticorps CG8327, anticorps Dmel\\CG8327, anticorps id:ibd1177, anticorps wu:fa18b03, anticorps zgc:63600, anticorps SRM, anticorps MGC83147, anticorps spermidine synthase, anticorps Spermidine Synthase, anticorps spermidine synthase L homeolog, anticorps Spermidine synthase, anticorps SRM, anticorps Srm, anticorps SpdS, anticorps srm, anticorps srm.L, anticorps PF11_0301, anticorps Slip_1383, anticorps Trad_0403, anticorps speE, anticorps Sgly_3176, anticorps Dester_0228, anticorps Fluta_3641, anticorps Mahau_0960

Sujet: Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine.

Poids moléculaire: 33 kDa

ID gène: 6723

UniProt: P19623