XRCC6 anticorps (N-Term)

N° du produit ABIN629624

Détail du produit anti-XRCC6 anticorps

Antigène: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XRCC6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: G22 P1 antibody was raised against the N terminal Of G22 1

Purification: Purified

Immunogène: G22 P1 antibody was raised using the N terminal Of G22 1 corresponding to a region with amino acids NFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVL

Information d'application

Indications d'application: WB: 0.6 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

G22P1 Blocking Peptide, catalog no. 33R-6687, is also available for use as a blocking control in assays to test for specificity of this G22P1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XRCC6

Antigène: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Autre désignation: G22P1 (XRCC6 Produits)

Synonymes: anticorps CTC75, anticorps CTCBF, anticorps G22P1, anticorps KU70, anticorps ML8, anticorps TLAA, anticorps 70kDa, anticorps G22p1, anticorps Ku70, anticorps Kup70, anticorps X-ray repair cross complementing 6, anticorps ATP-dependent DNA helicase II, 70 kDa subunit, anticorps X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog, anticorps X-ray repair complementing defective repair in Chinese hamster cells 6, anticorps XRCC6, anticorps Bm1_41430, anticorps xrcc6.L, anticorps Xrcc6

Sujet: The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Réparation de l'ADN