FAH anticorps

N° du produit ABIN629635

Détail du produit anti-FAH anticorps

Antigène: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAH Blocking Peptide, catalog no. 33R-1054, is also available for use as a blocking control in assays to test for specificity of this FAH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAH

Antigène: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Autre désignation: FAH (FAH Produits)

Synonymes: anticorps CG14993, anticorps Dmel\\CG14993, anticorps dfaa, anticorps l(3)64Al, anticorps l(3)SH11, anticorps PSPTO3550, anticorps fb59b12, anticorps wu:fb59b12, anticorps zgc:55316, anticorps FAA, anticorps Fumarylacetoacetase, anticorps FumarylAcetoacetate Hydrolase, anticorps fumarylacetoacetase, anticorps fumarylacetoacetate hydrolase, anticorps fumarylacetoacetate hydrolase (fumarylacetoacetase), anticorps fumarylacetoacetate hydrolase (fumarylacetoacetase) L homeolog, anticorps Faa, anticorps fah-1, anticorps fahA, anticorps hmgB, anticorps Ndas_1870, anticorps Lbys_3503, anticorps Riean_0663, anticorps Ftrac_0820, anticorps Celal_3675, anticorps Celly_2655, anticorps Weevi_0208, anticorps Fluta_2435, anticorps Halhy_2019, anticorps Lacal_2931, anticorps FsymDg_1892, anticorps Fah, anticorps fah, anticorps fah.L, anticorps FAH

Sujet: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.

Poids moléculaire: 46 kDa (MW of target protein)