WNT2B anticorps (Middle Region)
-
- Antigène Voir toutes WNT2B Anticorps
- WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WNT2B est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- WNT2 B antibody was raised against the middle region of WNT2
- Purification
- Purified
- Immunogène
- WNT2 B antibody was raised using the middle region of WNT2 corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
- Top Product
- Discover our top product WNT2B Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))
- Autre désignation
- WNT2B (WNT2B Produits)
- Synonymes
- anticorps WNT13, anticorps XWNT2, anticorps wnt2b, anticorps XWnt-2, anticorps Xwnt-2b, anticorps wnt-2b, anticorps xwnt2b, anticorps WNT2B, anticorps Wnt13, anticorps Wnt family member 2B, anticorps wingless-type MMTV integration site family, member 2Ba, anticorps Wnt family member 2B L homeolog, anticorps wingless-type MMTV integration site family, member 2B, anticorps wingless-type MMTV integration site family, member 2Bb, anticorps WNT2B, anticorps Wnt2b, anticorps wnt2ba, anticorps wnt2b.L, anticorps wnt2bb
- Sujet
- WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- Signalisation WNT
-