UBE2I anticorps
-
- Antigène Voir toutes UBE2I Anticorps
- UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBE2I est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- UBE2 I antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA
- Top Product
- Discover our top product UBE2I Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBE2I Blocking Peptide, catalog no. 33R-4311, is also available for use as a blocking control in assays to test for specificity of this UBE2I antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))
- Autre désignation
- UBE2I (UBE2I Produits)
- Synonymes
- anticorps C358B7.1, anticorps P18, anticorps UBC9, anticorps ubc9, anticorps ube2ia, anticorps zUbc9, anticorps 5830467E05Rik, anticorps F830028O17Rik, anticorps Ubce2i, anticorps Ubce9, anticorps UbcE2A, anticorps ubce9, anticorps T13J8.70, anticorps T13J8_70, anticorps UBIQUITIN-PROTEIN LIGASE, anticorps ubiquitin conjugating enzyme 9, anticorps ubiquitin conjugating enzyme E2 I, anticorps ubiquitin-conjugating enzyme E2Ib, anticorps ubiquitin-conjugating enzyme E2L, anticorps ubiquitin-conjugating enzyme E2I, anticorps ubiquitin conjugating enzyme E2I S homeolog, anticorps ubiquitin conjugating enzyme 9, anticorps SUMO-conjugating enzyme UBC9, anticorps UBE2I, anticorps ube2ib, anticorps UBE2L, anticorps Ube2i, anticorps ube2i.S, anticorps UBC9, anticorps ubc-9, anticorps LOC108703134
- Sujet
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2I is a member of the E2 ubiquitin-conjugating enzyme family.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Ubiquitin Proteasome Pathway
-