ACAT2 anticorps

N° du produit ABIN629656

Détail du produit anti-ACAT2 anticorps

Antigène: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACAT2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS

Information d'application

Indications d'application: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACAT2 Blocking Peptide, catalog no. 33R-9686, is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACAT2

Antigène: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Autre désignation: ACAT2 (ACAT2 Produits)

Synonymes: anticorps fb10a06, anticorps fb53f08, anticorps wu:fb10a06, anticorps wu:fb53f08, anticorps AW742799, anticorps Tcp-1x, anticorps Tcp1-rs1, anticorps Ab2-076, anticorps Acat3, anticorps EMB1276, anticorps EMBRYO DEFECTIVE 1276, anticorps MIF21.12, anticorps MIF21_12, anticorps acetoacetyl-CoA thiolase 2, anticorps acetyl-CoA acetyltransferase 2, anticorps acetyl-Coenzyme A acyltransferase 2, anticorps acetyl-Coenzyme A acetyltransferase 2, anticorps acetyl-CoA acetyltransferase 2 S homeolog, anticorps acetoacetyl-CoA thiolase 2, anticorps ACAT2, anticorps CNA05060, anticorps acat2, anticorps Acat2, anticorps acat2.S

Sujet: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Poids moléculaire: 44 kDa (MW of target protein)