ECHS1 anticorps (C-Term)
-
- Antigène Voir toutes ECHS1 Anticorps
- ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ECHS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ECHS1 antibody was raised against the C terminal of ECHS1
- Purification
- Purified
- Immunogène
- ECHS1 antibody was raised using the C terminal of ECHS1 corresponding to a region with amino acids KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
- Top Product
- Discover our top product ECHS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ECHS1 Blocking Peptide, catalog no. 33R-4359, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))
- Autre désignation
- ECHS1 (ECHS1 Produits)
- Synonymes
- anticorps SCEH, anticorps cOR6not, anticorps fj55e05, anticorps si:zc217g15.1, anticorps wu:fj55e05, anticorps C80529, anticorps enoyl-CoA hydratase, short chain, 1, mitochondrial L homeolog, anticorps enoyl-CoA hydratase, short chain 1, anticorps enoyl CoA hydratase, short chain, 1, mitochondrial, anticorps enoyl Coenzyme A hydratase, short chain, 1, mitochondrial, anticorps echs1.L, anticorps ECHS1, anticorps Echs1, anticorps echs1
- Sujet
- ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-