SCD anticorps

N° du produit ABIN629709

Détail du produit anti-SCD anticorps

Antigène: SCD (Stearoyl-CoA Desaturase (Delta-9-Desaturase) (SCD))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCD est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCD Blocking Peptide, catalog no. 33R-3805, is also available for use as a blocking control in assays to test for specificity of this SCD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCD

Antigène: SCD (Stearoyl-CoA Desaturase (Delta-9-Desaturase) (SCD))

Autre désignation: SCD (SCD Produits)

Synonymes: anticorps FADS5, anticorps MSTP008, anticorps SCD1, anticorps SCDOS, anticorps AA589638, anticorps AI265570, anticorps Scd, anticorps Scd-1, anticorps ab, anticorps SCD, anticorps fads5, anticorps scd1, anticorps scdos, anticorps F27J15.17, anticorps F27J15_17, anticorps STOMATAL CYTOKINESIS-DEFECTIVE 1, anticorps cds2, anticorps desaturase, anticorps stearoyl-CoA desaturase, anticorps acyl-CoA desaturase, anticorps Acyl-CoA desaturase, anticorps stearoyl-Coenzyme A desaturase 1, anticorps stearoyl-CoA desaturase (delta-9-desaturase), anticorps stearoyl-CoA desaturase (delta-9-desaturase) S homeolog, anticorps stomatal cytokinesis defective / SCD1 protein (SCD1), anticorps acyl-CoA desaturase-like, anticorps SCD, anticorps CIMG_08158, anticorps VIBHAR_RS23280, anticorps acod, anticorps Scd1, anticorps Scd, anticorps scd, anticorps LOC100346561, anticorps scd.S, anticorps SCD1, anticorps LOC100719661, anticorps LOC101835884, anticorps LOC109101093

Sujet: Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation