SCD anticorps

N° du produit ABIN629709

Cet anticorps anti-SCD Polyclonal Lapin (ABIN629709) détecte spécifiquement SCD dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SCD anticorps (ABIN629709)

Antigène: SCD (Stearoyl-CoA Desaturase (Delta-9-Desaturase) (SCD))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCD est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SCD anticorps

Purification: Purified

Immunogène: SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCD Blocking Peptide, (ABIN939191), is also available for use as a blocking control in assays to test for specificity of this SCD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCD

Antigène: SCD (Stearoyl-CoA Desaturase (Delta-9-Desaturase) (SCD))

Autre désignation: SCD

Sujet: Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation