AKAP7 anticorps

N° du produit ABIN629711

Détail du produit anti-AKAP7 anticorps

Antigène: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKAP7 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAET

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKAP7 Blocking Peptide, catalog no. 33R-4914, is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKAP7

Antigène: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Autre désignation: AKAP7 (AKAP7 Produits)

Synonymes: anticorps akap15, anticorps akap18, anticorps MGC83920, anticorps AKAP7, anticorps AKAP15, anticorps AKAP18, anticorps 6430401D08, anticorps AI662165, anticorps Akap18, anticorps BB170514, anticorps AKAP-18, anticorps AKAP18d, anticorps Akap15, anticorps A-kinase anchoring protein 7, anticorps A-kinase anchoring protein 7 L homeolog, anticorps A kinase (PRKA) anchor protein 7, anticorps AKAP7, anticorps akap7.L, anticorps akap7, anticorps Akap7

Sujet: AKAP7 encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations.

Poids moléculaire: 36 kDa (MW of target protein)