METTL1 anticorps (Middle Region)

N° du produit ABIN629728

Détail du produit anti-METTL1 anticorps

Antigène: METTL1 (Methyltransferase Like 1 (METTL1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: METTL1 antibody was raised against the middle region of METTL1

Purification: Purified

Immunogène: METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METTL1 Blocking Peptide, catalog no. 33R-4401, is also available for use as a blocking control in assays to test for specificity of this METTL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL1

Antigène: METTL1 (Methyltransferase Like 1 (METTL1))

Autre désignation: METTL1 (METTL1 Produits)

Synonymes: anticorps Dmel\\CG4045, anticorps EG:22E5.4, anticorps C12orf1, anticorps TRM8, anticorps TRMT8, anticorps YDL201w, anticorps 2810012D02Rik, anticorps CG4045 gene product from transcript CG4045-RA, anticorps methyltransferase like 1, anticorps methyltransferase like 1 L homeolog, anticorps tRNA (guanine46-N7)-methyltransferase, anticorps tRNA (guanine-N(1)-)-methyltransferase, anticorps tRNA (guanine-N7-)-methyltransferase, anticorps CG4045, anticorps METTL1, anticorps Mettl1, anticorps mettl1.L, anticorps CAALFM_C404810CA, anticorps LOC100280508, anticorps LOC732983

Sujet: METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.

Poids moléculaire: 34 kDa (MW of target protein)